SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g30200.1|PACid:21886448 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g30200.1|PACid:21886448
Domain Number 1 Region: 142-217
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.4e-27
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 40-100
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000392
Family BTB/POZ domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g30200.1|PACid:21886448
Sequence length 220
Sequence
MASTTAAAEDHKGKRPLPPEEADEAAAAPPPAAAEEEGEKLVLVSDDGVEVLASVAAARV
SKTLRGMIEDECATGAIPIAGVHSDVLALLVEYCERHAPHYDPEASDRDRYPFPPFPVEL
PPTASSIKPVTFVDPDADPHGLKAFDKKFLDVDNSTLFEIIMAANYLNIEELLDDACTAV
ADKMRGKKPEEIRDIFEIENDYTPEQEAEVRRENAWAFED
Download sequence
Identical sequences A0A0D3HE20 A0A0E0QZK0 I1QUV6 Q7XE44
39947.LOC_Os10g30200.1 XP_015613361.1.37577 OBART10G11220.1 LOC_Os10g30200.1|PACid:21886448 ORGLA10G0098900.1 LOC_Os10g30200.1|13110.m02595|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]