SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g30490.1|PACid:21884269 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g30490.1|PACid:21884269
Domain Number 1 Region: 19-140
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000374
Family Polygalacturonase inhibiting protein PGIP 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g30490.1|PACid:21884269
Sequence length 151
Sequence
MPVLALFILLAAGVAAAAATHPGDDVAMRSLANTTGTAKTLQWGASSPDPCGGTWVGVTC
NAEGRVTAINASRGGLTGHLVGADLSTLASLSDLDLSFNALRDDLPVLPQPLGGLRALDL
RSNSFFAITDGFFAAFPALETSTSTTTRCRP
Download sequence
Identical sequences A0A0E0QZM4 Q337T6
LOC_Os10g30490.1|13110.m02625|protein LOC_Os10g30490.1|PACid:21884269 39947.LOC_Os10g30490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]