SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g33950.1|PACid:21907043 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g33950.1|PACid:21907043
Domain Number 1 Region: 712-1043
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-63
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 
Domain Number 2 Region: 343-643
Classification Level Classification E-value
Superfamily L domain-like 6.57e-58
Family Polygalacturonase inhibiting protein PGIP 0.00039
Further Details:      
 
Domain Number 3 Region: 32-318
Classification Level Classification E-value
Superfamily L domain-like 3.55e-53
Family Polygalacturonase inhibiting protein PGIP 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g33950.1|PACid:21907043
Sequence length 1077
Sequence
MAIPILRRIIPLLMLLLTLWPVPSSSLPDEYSDREALLQFRAALSVSDQLGSLSSWNGST
GSDFCRWGGVTCSRRHPGRVTSLNLSSLGLAGSISPVIGNLTFLQSLDLFNNTLSGDVYF
TSQLHRLHYLELAYNDFSGDLPVGLCNCSNLVFLSVEANELHGAIPSCLGSLLQLKVLYL
GENNLTGTVPPSLGNLTMLLQIALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPL
FFNISSLQYLGFSSNKLHGRLPPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQV
LGLARNSFEGRIPPEIGKLCPVSVQMGSNKLQANDAGDWEFLRYFTNCTRLQVIDLSDNT
LGGILPSFIANLSRSIQWLSMAKNQISGIIPPGIGSLKGIEDLEFQGNNLFGDIPGDIGR
LRNLKVLWLNMNNMSGGIPFSIGNLTQLLTLDLSNNQLNGSIPKSLGSMERLTNLDLSSN
RLVESIPDVIFSLPSLTDSLLLSDNYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLG
DCASLVYLALDSNHFTGSIPPSLGNLRGLSILNLTRNALSGSIPQQLSNIHGLQQLYLAH
NNLSGTIPQFLEKSSALIELDLSYNHLSGEVPSHGLFANMSGFSVLGNYALCGGIAELNL
PPCEVKPHKLQKQMLLRILLLVSGIVICSSLLCVALFLFKGRKQTDRKNATSDLMLNEKY
PRVSYHELFEATDGFAPANLIGAGKYGSVYRGNLSLPSAVNVVVAVKVFTLQHASSSRSF
MAECEALRNVKHRNLIKIITCCSSMDSRGNDFRALVFEFMPKYSLDRWLHPRIHEQTHKL
SIAQLLNIAVDVADAIDHLHNNSCPTVIHCDLKPSNILLSADWTAYVADFGLAKLVGESI
EKSGLSAGDSSTVGIRGTIGYVAPEYGAGGQASVVGDAYSFGITLLEMFTGKAPTDNMFR
EGLTLHLHAEMTLPEKISEIIDPALLHVEQYDTDAEILTCLSSVIEVGVSCSKENPSERM
DMKHAAAKLNRIREEMRYDTIVRVLIPYLAIPKPSGSSLPPPQHRQTTQASIRIWMQ
Download sequence
Identical sequences A0A0E0MXD5
39947.LOC_Os01g33950.1 LOC_Os01g33950.1|13101.m03421|protein LOC_Os01g33950.1|PACid:21907043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]