SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g60280.1|PACid:21910070 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g60280.1|PACid:21910070
Domain Number 1 Region: 554-843
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-77
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 29-335
Classification Level Classification E-value
Superfamily L domain-like 6.23e-43
Family Polygalacturonase inhibiting protein PGIP 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g60280.1|PACid:21910070
Sequence length 909
Sequence
MANFRGFRRAVIVVVLCICHVNVVRGQSTDPAEVNALRAIKGRLIDPMNNLKNWNSGDPC
TSSWKGVFCDNIPINNYLHVTELQLFKMNLSGTLAPEIGLLSQLKTLDFMWNNLTGNIPK
EIGNIHTLRLIGTFSIKYPNQLLIDSTIREMCRQLIVVAYFHGTLNGNQLSGSLPDEIGY
LQNLNRLQIDQNEISGPIPKSFANLTSMRHLHMNNNSLSGQIPSELSRLPELLHLLVDSN
NLSGPLPPELAETRSLQILQADNNNFSGSSIPAAYENIPTLLKLSLRNCNLQGGIPDISG
IPQFGYLDFQNNSLGNIPAAFEPPEEVTILLYGNPVCTNSTPARAARLCQPTSVTEAPSG
QGSQVSINCSPCPTDKNYEYNPSSPLPCFCAVPLGVGFRLKSPGISDFRPYKEDFQKNLA
HLLVLADYQIYMERYIWEVGPRLNMHLKLFPNNTNLFNTSEVVRLRHLLAGWEITLSNVF
GPYELLNFTLGSYEDEFPTVASSGLKRGALAGILAGTITASIAASVFTTIFIMRRRSKRR
TTSRRSLLSRYSVKVDGVRCFTFDEMAAATNDFTDSAQVGQGGYGKVYKGNLTDGTAVAI
KRAHEGSLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSA
KSRRPLNFSQRIHIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGLSR
LAPVPDVDGTMPAHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKPIQ
HGKNIVREVNTAYQSGEIAGVIDERISSSSSPECVARLASLAVKCCKDETDARPSMADVV
RELDAIRSALPEGEELLPEYGDQSATSTSLTATGPLSSSSTTGALFISSGSGGHANSKSG
IPSGTVAPR
Download sequence
Identical sequences 39947.LOC_Os01g60280.1 LOC_Os01g60280.1|13101.m06416|protein LOC_Os01g60280.1|PACid:21910070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]