SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g72020.1|PACid:21907074 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g72020.1|PACid:21907074
Domain Number 1 Region: 280-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.24e-19
Family Ankyrin repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 9-53,95-180
Classification Level Classification E-value
Superfamily POZ domain 2.04e-17
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g72020.1|PACid:21907074
Sequence length 506
Sequence
MEETLKSLSMDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQA
AAPPGALLLDHLSPRSPSGGASASSPRGAGGSAAAAAAATPGAVIPVSSVSYEVFLLLLQ
FLYSGQVSLVPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQL
AGMVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDEL
RLKSMSRRSPFLSHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVKLMVM
GEGLNLDDALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVA
VLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMV
MSREDAQTAAVNAAPIYGESPGGGGGGGVYNASGTSSSMVNLSLDNRMVYLNLGMDAQFG
KMNDGGDGDDGGSRGPSSLFSPHGFP
Download sequence
Identical sequences A2CIR7 A2WZ25
LOC_Os01g72020.1|13101.m07846|protein OsIBCD004505 LOC_Os01g72020.1|PACid:21907074 XP_015627734.1.37577 39946.BGIOSIBCE004982 39947.LOC_Os01g72020.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]