SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g42640.1|PACid:21918316 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g42640.1|PACid:21918316
Domain Number 1 Region: 195-270,341-410
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000355
Family CBS-domain pair 0.0053
Further Details:      
 
Weak hits

Sequence:  LOC_Os02g42640.1|PACid:21918316
Domain Number - Region: 5-85
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00524
Family CBS-domain pair 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g42640.1|PACid:21918316
Sequence length 417
Sequence
MAASLLSHVVSDLCIGKPPARVLPPSTPVAAALAALRTGDDPFVFVVDADEALRHSRGKK
IAAGCVVVKVSVADVLCYVCGDADNLSDPAAALGRPVSALAAAVHAGGGDHHGAALRVDS
LTSLLDAIDALLSNDAQTLLVPLHAHAARSRKHHHVHVSGCSPANPAAATDYCVLTREDI
VRHLFSYSISLFAPVAARTVASLGLVRRDVHAVHADDDALDAIPLLRRSIADGTAVAVVA
DDDALVGEICPGVLGSCDIESASAAFAALSAGDVMTYIDCSLSPPEFLLRSIRAQLKGRG
MDAMADLMDAADDAASSLPLSPSSSSSASSDEDSPFGRARRARRSSSGSFRWRSTKDVAA
CHAGSSLVAVMAQALAHRVGYVWVVDEVSGALTGVVSFGDVLAVLREHLRDGDTQMN
Download sequence
Identical sequences 39947.LOC_Os02g42640.1 XP_015623906.1.37577 LOC_Os02g42640.1|13102.m04730|protein LOC_Os02g42640.1|PACid:21918316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]