SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g03430.1|PACid:21912256 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g03430.1|PACid:21912256
Domain Number 1 Region: 195-308,394-413
Classification Level Classification E-value
Superfamily CBS-domain pair 3.74e-16
Family CBS-domain pair 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g03430.1|PACid:21912256
Sequence length 518
Sequence
MSQHAVCCGAMFWVYLMSCVGLVMFAGLMSGLTLGLMSLSLVDLEVLAKAGTPTDKDNAA
RILPVVKNQHLLLCTLLIGNSLAMEALPIFLDSLVPSFGAILISVTLILAFGEIMPQAIC
TRYGLSVGAKAAPVVRVLLIVFFPVAYPISKLLDWVLGKGHVALMRRAELKTLVDMHGNE
AGKGGELTHDETTIITGALEMTQKTAKDAMTPISETFSLDINAKLDLHTMGMIMTKGHSR
VPIYSGTPNNIIGLILVKNLITCQPEDEVPIRNVTIRKIPRVSDDLPLYDILNEFQKGHS
HMAVVVRRIKEPGASIEKTYSDRSDYKTNSDRSDYKINHRDAHADGLSPSRVSIAGSRRS
NIEKNGEVRLYKKSEKKRDNILDFNSGPLPSYSLDQEAVGIITMEDVMEQLLQEDILDET
DEYVDVHNKIKINMLPLGKSLSPTISPSNGPHSQGLRRTPMTSPLSSYHHGGSILRSPAS
NNPQSPGTLPTIISPERSPASQAPSRSSPNSTQVSRNS
Download sequence
Identical sequences Q10SE0
XP_015630985.1.37577 LOC_Os03g03430.1|13103.m00325|protein LOC_Os03g03430.1|PACid:21912256 39947.LOC_Os03g03430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]