SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g42240.1|PACid:21911435 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g42240.1|PACid:21911435
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-20
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 223-327
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-18
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 3 Region: 440-530
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-17
Family B3 DNA binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g42240.1|PACid:21911435
Sequence length 536
Sequence
MAGGNTHRKKSCACCKEYLEHLGGKMRCFLRRMAADSMHSMIMPDRFVSHFGGKIPGTIK
LESPNGILYVVEVTECMNKTLLQCGWEAFVDAHNIKEGESLLFRHIENSRYEVLILDSDD
CEKVFSCAGIRNGSCVQDKTVDPVDSSGSSSNDTTQSSRSRNTENLTAMCSSSEKSGEDS
PSGYEFHESVEPQTPSGSDYVLSRRTYLSEAQKERVVTHIQDIQPEITVFVAVMKKCNLQ
SPAPYLVISSRYASVHFPRETATITLQRPSKRKKWYPRFYKRIDKSDHMLRGQWQNFVHD
NCLQEEDICLFVPTKGGRNFAFTVHLLQAEVTHSRDGTDVHKIGSSQNKRNSKMASQVHI
KEAPGGDVSSESNKHGVSHESLESEDSDGPSEPPYISSMRRRLSQLQKKTVEEKVRAIQS
EIPICVATISKLAGSGGKGKFRGLELSSRYAASYLPDKNHQTLVLQCKGMIWQINLVVRR
RYTKGKRWFLTAGWRKFAHDNRLRVGDFCLFELKKKKKLTMEVHIISNLQRYPEVE
Download sequence
Identical sequences Q6AV21
39947.LOC_Os03g42240.1 XP_015629380.1.37577 XP_015629381.1.37577 XP_015629382.1.37577 LOC_Os03g42240.1|PACid:21911435 LOC_Os03g42240.1|13103.m04547|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]