SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g42370.1|PACid:21914811 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g42370.1|PACid:21914811
Domain Number 1 Region: 18-116
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-25
Family B3 DNA binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 321-419
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-24
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 205-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-17
Family B3 DNA binding domain 0.0038
Further Details:      
 
Weak hits

Sequence:  LOC_Os03g42370.1|PACid:21914811
Domain Number - Region: 510-571
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0147
Family B3 DNA binding domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g42370.1|PACid:21914811
Sequence length 581
Sequence
MSKSGCERCRGRGFWDTDDQDTYFFKVMIGGFRRQMTIPYKFAENFRDQIQGTIKLKARN
GNTCSVLVDKCSNKLVLTKGWAEFANSHDIKMGDFLVFRYTGNSQFEVKIFDPSGCVKAA
SHNAVNIGQHAQNMQGDPIEILSCSDEHLRAQSLTTERQNQPEKDVIDNCNKKMKTEHAS
SSEDDQETPTAEVHRMKVEEMVRAIHSNHPVFVAVMKKSNVTRQPCYVAISRKYANEYFP
GGDQMLTLQRHGKRWQVKFCISKRKLRMLSKGWRKFTRDNELQVGAPLALFITLFFSPHF
RKMKKCGQKMRKLNTRSTARDDQEKYFFKVMIGDFHKRMTIPDKFARHFKGVISKTIKLE
PRSGYTFDVQVTKKLNILVLGSGWESFVNAHDLNMGDFLVFKYNGDFLLQVLIFDPSGCE
KSTSCSMENAIDHVGQGWKEHNDISTSYHDQPKGNKHWMQKDSSSKGNKIGNTRSSNTPS
KFSGCILPRGTCLPVVQEKKMKEKIQAIHSKTPMYGNVMTKCNVSGSPCVLEITQLYDDA
YLPFNNGQELMLRHRDKSWKVRFYRFKNKSRKLTQVCVVIR
Download sequence
Identical sequences LOC_Os03g42370.1|PACid:21914811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]