SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g44310.1|PACid:21911247 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g44310.1|PACid:21911247
Domain Number 1 Region: 287-605
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.6e-91
Family IF2B-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g44310.1|PACid:21911247
Sequence length 612
Sequence
MDLRRPPRSSSGGVEPKIRQVGFVTPDASSSAPPAEPPAAAAAAVAAAAAAASSAAAAAA
QAQASSEGSPPASELSPGSLSPVMIPPPRHADHLAPGSPSPAASPSELGDDESWSRAPSA
AELESNNNDLAEIRNDNVPASIPQKQKTSKAERRAIQEAQRAAKAAAKEAGLSGKSAGTG
SGANPAMPKQAKSSKVSQKKDVPQAASTAASEKKVTERPSERDRKKDAPHPRMQFDDVHR
VEKAKKRAIVNQSEARNRVELFRHLPQYVHGTQLPGLESKFFQLEPMHPSVYKVGLQYLS
GEVSGGNGRCIAMLLAFQVAIKDYSTPPKKTLSRDLTAKISSYVSFLIECRPLSISMGNA
IRFLKNRIAKLPLTLSESEAKASLQSDIDRFINEKIVVADKVIVSHAITKVRDNDVLLTY
GSSSVVEMILDHAHELGRKFRVIVVDSRPKLEGQGLLRRLVEKGINCTYTHINAISYIMH
EVTRVFLGASSILSNGTVYSRVGTASVAMVAHAFGIPVLVCCEAYKFHERVQLDSICANE
LGDPDVILKVPGKADLGHLKNLADNENLQLLNLTYDATPSDYVSMIITDYGMLPPTSVPV
IVREYRKEQLWI
Download sequence
Identical sequences Q10G37
LOC_Os03g44310.1|PACid:21911247 XP_015631373.1.37577 LOC_Os03g44310.1|13103.m04769|protein 39947.LOC_Os03g44310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]