SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g46440.1|PACid:21915117 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g46440.1|PACid:21915117
Domain Number 1 Region: 264-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-16
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 65-185
Classification Level Classification E-value
Superfamily POZ domain 0.000000022
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g46440.1|PACid:21915117
Sequence length 589
Sequence
METSTISFSSSSPPSPPPPQPAPGDIDAVSLGRLSRNLENLLDPAFLNCADAEIVLASGG
GDPGGGAVVGVHRCILAARSRFFYDHFSSAPAPAPATAGDKPQLDLDGLVPGGRHIGRDA
LVAVLSYLYTGRLRSAPPEAAACLDDGCSHDACRPAIDFVVESTYAASGFQISELVSLFQ
RRLSDFVNKALAEDILPILVVASTCHLPELLNQCIQRVANSNLDNRYLEKRLPDDLYAKL
KEFRVPDEPHSGILDPEHEKRVRNIHKALDSDDVDLVGMLLKESPVTLDDAFAIHYAAAY
CEPKVLAELLKLESANVNLKNSSGYTPLHMACMRREPDIIVSLIEKGASVLERTQDGRDA
LTICKRLTREKDRNEKSEKCKERSKAYLCIGVLQQEIKRRPQILEDQMSAEESIATPLLV
DNFHMRLLNLENRVAFARIFFPSEAKLVMRIAQADSTQEFAGLTSANFSKLKEVDLNETP
TMQNRRLRERLDALTKTVELGRRYFPHCSEVLDKFLNEESTDLILLESGTAEDQQTKRMR
FSELREDVRKAFTKDKAAGAAISSSTSASSSPRYETKLRPGNKKGKLSR
Download sequence
Identical sequences A0A0E0NZ91 Q75HA6
OsIBCD011480 LOC_Os03g46440.1|PACid:21915117 XP_015632015.1.37577 39947.LOC_Os03g46440.1 LOC_Os03g46440.1|13103.m04999|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]