SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g47120.1|PACid:21916018 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g47120.1|PACid:21916018
Domain Number 1 Region: 194-308,387-406
Classification Level Classification E-value
Superfamily CBS-domain pair 7.87e-19
Family CBS-domain pair 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g47120.1|PACid:21916018
Sequence length 420
Sequence
MAVEYHCCGAAFFEHVVIIVVLVLFAGLMSGLTLGLMSLSLVDLEVLAKSGTDQDRKHAA
KILPVVKNQHLLLCTLLICNAAAMEALPIFLDSLVTAWGAILISVTLILLFGEILPQSIC
SRYGLAIGASVAPLVRVLVWVCFPVAYPISKLLDHLLGKGHTALFRRAELKTLVTLHGNE
AGKGGELTHDETTIIAGALELTEKKAKDAMTPLCQTFAIDINAKLDRDLMQKVLDKGHSR
VPVYYEKKTNIIGLILVKNLLSINPDDEIPIKSVTIRKIPRVSEDMPLYDILNEFQKGHS
HMAVVIRQTNANYAAEPPANDGGTLEVAISIDDKHGEKVVKNLPPLRRWKSCPNSQNSNR
GNRNRKWSKDQSDVLQIHEEPLPTLNEDEEAVGIITMEDVIEELLQEEIYDETDVHVEEQ
Download sequence
Identical sequences B8AP49 Q75LY7
LOC_Os03g47120.1|13103.m05073|protein XP_015628261.1.37577 OsIBCD011541 39946.BGIOSIBCE012460 39947.LOC_Os03g47120.1 LOC_Os03g47120.1|PACid:21916018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]