SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g50810.1|PACid:21912399 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g50810.1|PACid:21912399
Domain Number 1 Region: 584-894
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.95e-80
Family Protein kinases, catalytic subunit 0.0000652
Further Details:      
 
Domain Number 2 Region: 76-319,381-452
Classification Level Classification E-value
Superfamily L domain-like 2.21e-49
Family Polygalacturonase inhibiting protein PGIP 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g50810.1|PACid:21912399
Sequence length 962
Sequence
MWRRRRGGGGGGGGGGVAVAVALAVMLVVGAAAGETAASDAAAMRAVARALGADKALGWS
TGDPCSSPRAWAGVTCDSAGRVTAVQVGNRSLTGRLAPEVRNLTALARLELFDNSISGEL
PSLAGLSSLQYLLVHNNGFTRIPPDFFKGLTALAAVSLDNNPFDPWPLPADLADCTSLTN
FSANTANVTGALPDFFGTALPSLQRLSLAFNKMSGPVPASLATAPLQALWLNNQIGENQF
NGSISFISNMTSLQELWLHSNDFTGPLPDFSGLASLSDLELRDNQLTGPVPDSLLKLGSL
TKVTLTNNLLQGPTPKFADKVKADVVPTTERFCLSTPGQPCDPRVNLLLEVAAEFQYPAK
LADNWKGNDPCDGYIGVGCDAGNITVLNFARMGFSGSISPAIGKITTLQKLILADNNITG
TVPKEVAALPALTEVDLSNNNLYGKLPTFAAKNVLVKANGNPNIGKDAPAPSGSGGSGGS
NAPDGGNGGDGSNGSPSSSSAGIIAGSVVGAIAGVGLLAALGFYCYKRKQKPFGRVQSPH
AMVVHPRHSGSDPDMVKITVAGGNVNGGAAASETYSQASSGPRDIHVVETGNMVISIQVL
RNVTNNFSDENVLGRGGFGTVYKGELHDGTKIAVKRMEAGVMGNKGLNEFKSEIAVLTKV
RHRNLVSLLGYCLDGNERILVYEYMPQGTLSQHLFEWKEHNLRPLEWKKRLSIALDVARG
VEYLHSLAQQTFIHRDLKPSNILLGDDMKAKVADFGLVRLAPADGKCVSVETRLAGTFGY
LAPEYAVTGRVTTKADVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMQLSKDTFQ
KAIDPTIDLTEETLASVSTVAELAGHCCAREPHQRPDMGHAVNVLSTLSDVWKPSDPDSD
DSYGIDLDMTLPQALKKWQAFEDSSHFDGATSSFLASLDNTQTSIPTRPPGFAESFTSAD
GR
Download sequence
Identical sequences A0A0E0P0H4 Q10DW6
LOC_Os03g50810.1|PACid:21912399 XP_015631965.1.37577 39947.LOC_Os03g50810.1 LOC_Os03g50810.1|13103.m05526|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]