SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g51440.1|PACid:21912747 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g51440.1|PACid:21912747
Domain Number 1 Region: 422-718
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.99e-37
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 72-83,111-279
Classification Level Classification E-value
Superfamily L domain-like 1.08e-28
Family Polygalacturonase inhibiting protein PGIP 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g51440.1|PACid:21912747
Sequence length 809
Sequence
MEEEEMMRAGGCCCGGGGVWARLLLLVAVVAAPGAVVAQQGNLTSRADLSGLYALRGSLG
LRARDWPRRADPCTAWAGVRCSGGRVVSVDLAGLRRTRLGRLAPRFAVDGLRNLTRLEAF
SAPGFGLPGSLPAWLGAGLAPTFQLLDISGCAVTGEIPASAIAGLSNLTTLNLAGNLLSG
QLPGSALAGLARLKTLNLSGNAFSGELPKAVWSLPELSVLDVSRTNLTGALPDTGLALPS
NVQVVDLSGNLFYGGVPGSFGQLFGRTKLANISGNYFDGKLGVSNGDGGNFSFELNCFVD
VTGQRSQAECQQFYAARGLPYNVSGPAPTPQPAMPASPGRKKGHKNLKYILIGAICGGVL
LVAVIAAILYCLVCSGSRRNGSRNDQRESGVRNTQLGASGTGGGAVTAGTQPSASPANLA
KVGDSFGYDQLVEATTDFGDDRLIKHGHSGDLYLGALHDGTSVVVKRITSSMAKKDAYMA
ELDLFAKGLHERLVPIMGHCLDKEEEKFLVYIFVRNGDLSSALHRKSGEEEEGLQSLDWI
KRLKIATGVAEALCYLHHECNPPMVHRDVQASSILLDDKFDVRLGSLSEVCPQEGEGHQN
VITKLLRFSSTADQGSSGSPSASCSYDVYCFGKVLLELVTGRLGISASNDAATNEWLDHT
LRYINIYEKELMSKIIDPSLIIDEDHLEEVWAMAIVAKSCLNPRSSKRPPMKYILKALEN
PLKVVREDNGGSSSARLRATSSRGSWNAAFFGSWRHSSSDIGPSRDDNLLKRSETIKSSG
GSNGDHSSSRRRQSKEIFPEPSGSRDTED
Download sequence
Identical sequences A0A0P0W3C8
LOC_Os03g51440.1|PACid:21912747 39947.LOC_Os03g51440.1 XP_015632675.1.37577 LOC_Os03g51440.1|13103.m05592|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]