SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g57780.1|PACid:21912640 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g57780.1|PACid:21912640
Domain Number 1 Region: 34-72,107-348
Classification Level Classification E-value
Superfamily L domain-like 6.8e-49
Family Polygalacturonase inhibiting protein PGIP 0.0028
Further Details:      
 
Domain Number 2 Region: 472-762
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.12e-45
Family Protein kinases, catalytic subunit 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g57780.1|PACid:21912640
Sequence length 839
Sequence
MRASPMAGASHHLVVFLAALLALLPGSSQLQYSQTWTLFKIQQMLNHPPVLSHWRRTTDF
CGGGGTAAPSAAVVCYGDTVTQLHIAGVRGAPPLPMNFSIGALVMALSRLPDLKVLTLSG
LGLWGPLPDKIGRLAALEIVNMSGNYLYGGVPGGLSQLTGLQTLILDDNLLAGELPAWIG
ELPQLAVLSLRNNSLGGAVPASVGRMESLRSLVLASNNLTGNLPDMSGLTNLQVIDVGDN
WLGPAFPALGRKVVTVVLSRNRFTGGLPGEITSFYLLERLDVSWNRFVGPFMPALLSLPA
IRYLNVAGNRFTGVLSDKVACGDNLQFVDLSSNLLTGSEPACLRPDKKPATVVLVNANCL
EATGGDASQHPSPFCQNQALAVGITHGGKVRKKLTHHAGFLAGIAMAALAAASAIAVVAV
VAVRRKNKKGVMVRPPAMLGEDNSSSTSGYPSKMFADARYISQTVKLGALGIPPYRTFSL
VELEAATDNFENSLLLGQDSFGEMYRGRLGNGTLVAIRSLKVKRNQSSLSFSRHIETISR
LRHRNLVSALGHCFEYDLDDSTVTQLYLVFEYVQNGNLRSRISQGTEGRKLTWAQRISAA
IGIANGIQFLHAGMMPGLFGNNLKINNILLDQNHVAKISSYNIPILGEAMKSEKGGPGGK
HHTESPLLNDKTDIFDFGVILLEIVSGKPITSLYEVEIMKELMLWAVADEDLVRRRSFAD
QEVSKGCSDESLRTIMQICLRCLAKEAVQRPSIEDVLWNLQFAAQVQDDWEGDNRSSDGS
MVSSSSRITKSSRFQNEQTRSGREKECEDSSARGSVWLQAATEDGNFETGRRQAEDERY
Download sequence
Identical sequences Q852J5
XP_015631387.1.37577 XP_015631388.1.37577 LOC_Os03g57780.1|13103.m06336|protein 39947.LOC_Os03g57780.1 LOC_Os03g57780.1|PACid:21912640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]