SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g52590.1|PACid:21894830 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g52590.1|PACid:21894830
Domain Number 1 Region: 565-854
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.79e-79
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 93-307
Classification Level Classification E-value
Superfamily L domain-like 1.19e-48
Family Polygalacturonase inhibiting protein PGIP 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g52590.1|PACid:21894830
Sequence length 930
Sequence
MDPRLSYCCYLHGCLCVLVLLLCSWRAADAQAQQPPPHTDPTEAAALNAMMARLGLSAPP
SWNISSDPCSGAATDDTPLDDNPAFNPAIKCDCSDHNNTLCHITRLKINTLDVVGPIPEE
LRNLTHLIKLDFRKNYFTGPLPAFIGELTALKYITVGINALSGPIPKELGNLTNLVSLAL
GSNNFNGSLPDELGKLTKLQQLWALDNNFTGQIPDYLGSLTNLTQLRLQGNSFQGPIPRS
LYNLVKLRSFVLRNSRISDSLASVDFSKFGSLNLLDLSFNNITGQIPPSIVNLPSLTFLN
LVANDFVIDGTDMSGLPWGLNCLQRNTPCFLGSPKSASFAVDCGGSRTISGSDNAMYQAD
NANLGAASYYVAGTPTWGVSTTGRFMDPPNGSYIIYSSRQFDKTLDSGLFQTARMSPSSL
RYYGIGLENGNYTVTLQFAEVDFPDVQSWRSRGRRIFDIYIQVACKLTISLGERKEQNFD
IRKAAGGKSFTVVKKQYVVPVTKNFLEIHLFWAGKGTCCIPHQGYYGPAISALSATPIFA
LAALAGHFIWRQKKRKILLELEELYNIVGRPNVFSYNELRSATENFSSSNLLGEGGYGLV
HKGRLSDGRAVAVKQLSQSSNQGKKQFATEIETISRVQHCNLVTLYGCCLESNTPLLVYE
YLENGSLDQALFGKGSLNLDWPTRFEICLGLARGIAYLHEDSTVRIVHRDIKASNVLLDA
GLNPKISDFGLAKLYDNKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGVVALETV
AGESNYQNTLEEDRTYIFERVWELYENGHPLDFVDPKLSEFNSEEVIRVIRVALLCTQGS
PHKRPPMSKVVSMLTGDADITEDAAKPSYITEWQIKVGSCHHTGSSQVGSASTPPSSGDG
GAGQASSQGAGEGSPLTPSPLFTSIIDEGR
Download sequence
Identical sequences LOC_Os04g52590.1|PACid:21894830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]