SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g32850.2|PACid:21939594 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g32850.2|PACid:21939594
Domain Number 1 Region: 239-352,427-446
Classification Level Classification E-value
Superfamily CBS-domain pair 2.14e-19
Family CBS-domain pair 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g32850.2|PACid:21939594
Sequence length 507
Sequence
MAAAVGRARGAASLAAAVRVAAATARPASSVAAAAGLGFAGLVVQGEDTPFGSVWWWAYA
GISCFLVLFAGIMSGLTLGLMSLGLVELEILQRSGTDAEKAQAAAILPVVQKQHQLLVTL
LLCNACAMEALPIFLDRIFHPVVAVILSVTFVLAFGEVIPQAICTRYGLAVGANFVWLVR
ILMIICYPISYPIGKLLDCALGHNESALFRRAQLKALVSIHSKEAGKGGELTHDETTIIS
GALDLTEKTAEEAMTPIESTFSLDVDSKLDWEAIGKILARGHSRVPVYSGNPRNIIGLLL
VKSLLTVRAETETPVSAVSIRRIPRVPADMPLYDILNEFQKGSSHMAAVVKAKPKIVPLP
DKTEPNREVSGAPQLTAPLLSNNEERVESLVVDIEKPQSRQVNGNKPCSMQQNEMPYAMS
RSSEDIDDGEVIGIITLEDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSVARAPSI
RRLTGQKGTVSAIFCYSFIVILVTMMV
Download sequence
Identical sequences LOC_Os05g32850.2|13105.m03387|protein LOC_Os05g32850.2|PACid:21939594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]