SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g40270.1|PACid:21943805 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g40270.1|PACid:21943805
Domain Number 1 Region: 591-886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.38e-77
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 43-420
Classification Level Classification E-value
Superfamily L domain-like 1e-54
Family Polygalacturonase inhibiting protein PGIP 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g40270.1|PACid:21943805
Sequence length 952
Sequence
MINFGGVLCAVTLVVLLPFLEAADGKSTDPSEVSALMAIKGSLVDPMNNLKNWNRGDPCT
KNWTGVFCHDLGDTYLHVTELQLFRRNLSGNLVPEVSLLSQLKILDFMWNNLTGNIPKEI
GNITTLKLILLNGNQLSGLLPDEIGNLQSLTRLQVDQNHLSGAIPKSFANLRSVKHLHMN
NNSLSGQIPSELSRLNTLLHLLVDNNNLSGPLPPELAAAKSLKILQADNNNFSGSSIPTL
YYNMSGLFKLSLRNCSLQGAIPDLSAIPQLDYLDLSWNQLTGSIPTNKLASNITTIDLSH
NMLNGTIPSNFSGLPYLQLLSLKNNLLDGSVPSEIWAGVNPNRNGSLVLDFQNNSLNMLP
AEISPPPPNVTVVLYGNPICENSSETLIINLCRLQSINLEKSKQETSTAMVCGACPTEKN
YEYNPSFSDQCFCAVPLGVGLRLKSPGVTDFHPYENAFKIDLTSLLQLFPYQLYIENYIW
EVGPRLNMHLKLFPSNTSLFNMSEVVRLRHVLAGWEITLLDVFGPYELLNFTLGSYEDEY
PNLASSGLSKAALGGILASTIASAIALSAVVTALIMRRNSRTNRISRRSLSRFSVKIDGV
RCFTYEEMASATNNFDMSAQVGQGGYGIVYKGILADGTIVAIKRAHEDSLQGSTEFCTEI
ELLSRLHHRNLVALVGYCDEENEQMLVYEFMPNGTLRDHLSGKSKPPLGFGLRLHIALGA
SKGILYLHTDADPPIFHRDVKASNILLDSKYVAKVADFGLSRLAPVPDVEGALPAHVSTV
VKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIEHGKNIVREVKKAYRSGNI
SEIMDTRMGLCSPECVDSFLQLAMKCSRDETDARPSMTEIVRELELILKIMPEGDLIQLE
TPQTYSGRAMSKDPMSKSTSNSTNGNYLASSQTFTSVDASSSGVLSGMVSPR
Download sequence
Identical sequences A0A0P0WNS8
XP_015639485.1.37577 XP_015639486.1.37577 XP_015639487.1.37577 XP_015639488.1.37577 LOC_Os05g40270.1|PACid:21943805 LOC_Os05g40270.2|PACid:21943806 LOC_Os05g40270.3|PACid:21943807 LOC_Os05g40270.4|PACid:21943808 LOC_Os05g40270.5|PACid:21943809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]