SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g02350.1|PACid:21933165 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g02350.1|PACid:21933165
Domain Number 1 Region: 66-139
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.63e-20
Family Skp1 dimerisation domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 11-54
Classification Level Classification E-value
Superfamily POZ domain 0.0000145
Family BTB/POZ domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g02350.1|PACid:21933165
Sequence length 142
Sequence
MAAAEEKKKKKMIKVMSSDGETFEMTEAAASMTAAPTAAPASLSKIIEYCTKHAAVEGRS
TAAAELKRFDEELIDVDTDTLYHLLMAGNLMGVEGVLELAVQRTAELIRGKSPEEIRDTF
KIANDFTPEEEEIIKENAWALQ
Download sequence
Identical sequences 39947.LOC_Os06g02350.1 LOC_Os06g02350.1|PACid:21933165 LOC_Os06g02350.1|13106.m00154|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]