SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g47550.4|PACid:21930811 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g47550.4|PACid:21930811
Domain Number 1 Region: 256-341
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-17
Family Calcium ATPase, transduction domain A 0.011
Further Details:      
 
Domain Number 2 Region: 437-460,504-566,595-672
Classification Level Classification E-value
Superfamily HAD-like 0.00000000000103
Family Meta-cation ATPase, catalytic domain P 0.02
Further Details:      
 
Domain Number 3 Region: 184-236,343-442
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000327
Family Calcium ATPase, transmembrane domain M 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g47550.4|PACid:21930811
Sequence length 698
Sequence
MQLLTAASASASSAAASPPSAHLLRLSRPPPFPHLRRRCAPHLPSKPLNLAARSPLLLAR
RSLPFAPRAHGDHHHGHHHHHHGHGHSHHHGPEVHGSGGGAAVMRVAKAIGWADVADALR
EHLQLCCISLGLLLIAAACPHIPVLNSVRRLQDALIAVAFPLVGVSAALDALVNIADGKI
NIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEHFTSKSMIDVRELKENHPEFALL
LETCGDQSAQFANLCYTKVPVHDLEVGSHILVRAGEAVPVDGEVYQGSSTVTIEHLTGET
KPLERTVGDAIPGGARNLEGMMIVKVTKSWEDSTLNRIVQLTEEGQLNKPKLQRWLDEFG
EHYSRVVVVLSLVVALLGPLLFKWPFFGNSVCRGSIYRGLGLMVAASPCALAVAPLAYAT
AISSLASKGILLKGGHVLDALSACQSIAFDKTGTLTTGKLMCKAIEPIHGHSDVTNDFSD
QACCTPNCESEALAVAAAMEKGTTHPIGRAVLDHSVGKDLPLVAVESFECLPGRGVVATL
SGVKAGNNEDELSKASIGSVEYISSLYRSSGESEQIKEAVKASAFGPEFVQAALTVDKKV
TLFHFEDEPRSGVCEVISTLRDKAKLRIMMLTGDHESSALRVAKAVCIDEVHCCLKPEDK
LNKVKAVSREGGRSISYDCKFSVKWLYDGIFASFSVVT
Download sequence
Identical sequences LOC_Os06g47550.2|PACid:21930810 LOC_Os06g47550.4|PACid:21930811 LOC_Os06g47550.2|13106.m05048|protein LOC_Os06g47550.4|13106.m05046|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]