SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g08540.1|PACid:21901589 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g08540.1|PACid:21901589
Domain Number 1 Region: 119-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-16
Family B3 DNA binding domain 0.017
Further Details:      
 
Domain Number 2 Region: 439-539
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-16
Family B3 DNA binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g08540.1|PACid:21901589
Sequence length 762
Sequence
MAAAAAALADDGDGIVDRAMWLACAAPNSGRLPAVGSMVFYFVDGHAEQFCQFPAPLLEQ
LAVPGPRVFLCTVAAVRLRADALTNEAYADITLDPVADHDVPRLLPAPAPAAAAGGQQQQ
LRYFVKTLMSSDAEYRDRFAVPMDVAKDVFPPLVDAKAVQPLIVKDLQGSPMTFDYGRNG
NRVTLAKVWKKFRDDMDFVDGDSVIFMRRRDDDELYVGVRRQRTLDKPLRTRRSRPPTPL
PVAVQEVIAAAGRAAAGEQFTATYRSRQDGDEFVVPREVVEEGLRLRSRFTPEMEVEFVW
ALEDGAPPSVGPHGKITAIHDTTWMWRSVEIGWTGGSEMNKYANFWQVRLVGSDDFASAA
PPPPLSPKRLKSSEQCPSRPPEPLPGRVFLCKVTAVRLDATRNELFATMSLIPVARDQAI
QPQAPADPGPSSPQVQTTLVSFVKPLTCTDAVKNRYRFIVPKRETAMGVLPQLQLNEHVP
LYIKDMHGKEWVINYTWKEYTHMLSSGWIKFANANRLVTGDNVVFMRSMDSGERYMGLRR
TLKPEPVSVDEVIEAVWRAARLEPFEVTYLSRQDGDEFVVPCGIVHNALRAKFTPGMVVN
FVWAVEEDRLPNVGPQGKVIAIENYATSIWRMIQVEWPSCAGMNRYVNFWQIREVLGESS
FEASTCIVRSQDYSPAPQRNLVNALQLPDGTKQLQQNKKSVSSSSTFRLFGKKMTPGVPP
RRDTSGLSGQVSLFSHYLPHDEDDGQVPTMRQRLETLFPDNI
Download sequence
Identical sequences Q8H506
LOC_Os07g08540.1|PACid:21901589 LOC_Os07g08540.1|13107.m00847|protein 39947.LOC_Os07g08540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]