SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g07890.1|PACid:21890890 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g07890.1|PACid:21890890
Domain Number 1 Region: 1301-1594
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-74
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 154-381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.03e-44
Family G proteins 0.042
Further Details:      
 
Domain Number 3 Region: 894-1169
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-40
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 4 Region: 444-820
Classification Level Classification E-value
Superfamily L domain-like 2.62e-31
Family Internalin LRR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g07890.1|PACid:21890890
Sequence length 1686
Sequence
MAMMLVRVSTRVMNTVLSKLSKMLEDKYTKLKGVHSQIAFFRDELSSMKAALEMLESVEE
LDPLHKDWRDTVRELAYDIEDFIDSFLVLVDHKQDEQSTFFKGFSYKLKKMKACHEISNE
IEELKTRVIEASKRHKRYNFIGLVASCTTSDIDPRLPALYVEVDELVGINGPKEHIMEWF
AKGIRDVKVKVLSIVGSGGLGITDYTSEDERQLIDRIRDRLKDKRYFVVIDDVWDVEAWK
VVSLALFNNRCGSRIVMTTRNAAVASHCSSDGGCVYQMEPLNFADSKMLFCQKAFRSREL
YNPHLEKVCDEILAKCGGLPLAIITVSSLLAGKHAKDEWDRMLNDIGCALANNPDAGNMT
KILSLSYFELPHHLRTCFLYLCIFPEDYKVNKQRLINRWIAEGFVHEKQGWSTYEVGQNY
FNDLINRSLIQPVDLKYGQAKACRVHDIILDFITCKATKENFVTTLDFAEHGHISKFRVR
RLCAKNHNEEKVNKSASLNLSHVRSLTIFQHVNGTSLFVFPTLRVLDLSKSGLTENHLES
IDKLHHLKYLSLRSTSITKLPTKIEQLHYLQTLDICDTKIQELPLSIAKLECLAHLYVER
WTRFPDGLIGKMQSLEELEEFGIYCELGKSLEGFSQLTKLRTLKVHLFWWSDAEECQNYV
SALLSSNLHHLYLTGGPLTLESWYPPTPCIIRKLHIKGCYNRKVPNWMSYLGSLTELQLW
IRRMGPNDVKILGAIPSLHFLEVRTLCGTNGRIIICGNQGFRSLRYFSLRIKRCGTMLEF
EAGSMPKLEHLQLEFRLHGMDCLNGASDFGIQNLSTLTKVEIGIWGNIYSDGIYDPAQDM
DDSITRSVVSLIKATIETLPNCPTSRFQLEYDCGNCLLGETSQEFEGQGPDEAYPHEHKI
FSLQELQDATDFFSNNNVLVDLFDSKLYKGRLQDGSLVVVHMDCPTADWSRRTRQFQTQV
EMPVHRNLYEDIEHLLSGCYSTERPPSQAPLDWQTRLRIALGSARGLSYLHDHCDPKIIH
RDIRAVNIFLNEDFEALVGNFCLAKLEDDMDTDDRTAVRGVVGHIAPEYLSAGILSEKTD
VYGYGIMLLELITGKRALYHDGRARDEDIFLLDWVKRLLKEKKLKMLVDPDLRNNYIHVE
VKSLIKVALICTQVSPVKRPKMVEVVRMLEGGDGLAQRWEVWWKIEVVRQEVPLTSSFSL
SAPNSFANNTSLCGLGTPSAPPLHPPPPYNPGDSFRFTAMQQPLFPPVRCGTYAGRSSRT
GAISGGVAAGAALLFNIPAIGFAWWRRRKPQEYFPVVPGVHLGQLKRFSLRELQVATKTF
NNKNILGTGGFSKVYKGRLADGSLVAVKRLKEQRTPGGELQFQTEVEMISMALHRNLLRL
RGFCMTPTERLLVYPYMANGSVASRLRERPPSEPPLDWQTRRRIAAGSARGLSYLHDHCN
PKIIHRDVKAANILLDEDFEAVFGDFGLAKPMDYKDTHVTTAVHGTIGHIAPEYLSTGIL
SEKTDVFGYGIMLLELITGKRAFDLALLARGEGVMPLDWVKRLIKEEKLEKLIDPDLQNK
YIDAEVESLIQVALLCTQGSPLERPKMAAVVRMLDEGDGLAERWKEWQKIEIVQQDVELG
LYQNGWTVDSTENLHAVELSGPRWIGQFGPVMAVFFLGRLYVYLRLTLLGTLSTLGGRTG
IDIVQR
Download sequence
Identical sequences LOC_Os08g07890.1|PACid:21890890 39947.LOC_Os08g07890.1 LOC_Os08g07890.1|13108.m00812|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]