SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g25320.1|PACid:21884176 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g25320.1|PACid:21884176
Domain Number 1 Region: 4-95,175-405
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.65e-82
Family IF2B-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g25320.1|PACid:21884176
Sequence length 415
Sequence
MPDVQPLVSEFVLKLKRRKVEGSHAVARQTAELLRSVVSQHRMGSTNQAAALADAVRGVG
EQLIAANPIELAVGNIVRRVLHIIKEEDISSTAVGIEGLSVTAESDDEYDSGNDDHPTLS
AAVLAAHARNALRAPSLQTLLEDIPVSTALSRSASSAGDSDGKSAGDKSSKSRKLKHDVI
AAIGDLIDEIDTCYDQISEQAVEHIHQNEVILTLGRSRTVKEFLYAAKEKKRSFRVFVAE
GAPRYKGHVLAKELVEKGVQTTVITDSAVFAMISRVNMVIVGAHAIMANGGVIAPVGMNM
VALAAQRHAVPFVVVAGSHKLCPLYPHNPEVLLNELKSPSDLLDFGEFSSCMNFSTQDGT
PLLNVVNPTFDYVPPKLVSLFITDTGGHSPSYMYRLIAEYYSADDLVVRRKSTSS
Download sequence
Identical sequences Q338M7
XP_015614907.1.37577 39947.LOC_Os10g25320.1 LOC_Os10g25320.1|PACid:21884176 LOC_Os10g25320.1|13110.m02134|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]