SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g35630.1|PACid:21884464 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g35630.1|PACid:21884464
Domain Number 1 Region: 173-249,312-382
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000115
Family CBS-domain pair 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g35630.1|PACid:21884464
Sequence length 385
Sequence
MAVRLLANEVSDLCIGKPAVRSLPLSAAAGDLAAALRRGPQQAAGGAAACVAVVGPGRAV
AGRLGLADVLCFLCAAPGALAHPTAALSKPASALLPKDGAGEVRRVDPRASVLEALDAVL
SGAQVLAVPLRSGGRRKQLGGGGGGGGGGDYCWLTQEDLVRYFLNSISLFSHVAGRSVSS
LGLVRADDLLTVRPHEAALSAVPLLRRAIATETAVAVVDDGGHLVGEISPALLASCDETA
AAAIATLSVADLMAYVDYFGAPPEHILRAVKAGLKSKGLDAMLELVENEAVSSFAFSSSS
TSSSSDDEAHGRAARLRRPSSGSYGRRSTEEPVVCSPASSLVAVMMQALAHRASYLWVLD
EDDDCRLAGIVTFADVLTVFREQLQ
Download sequence
Identical sequences A0A0D3HF98 A0A0E0IUR5 A0A0E0R0Z6 A2Z908 Q8LNH1
LOC_Os10g35630.1|PACid:21884464 XP_015614860.1.37577 OBART10G14660.1 LOC_Os10g35630.1|13110.m03203|protein OsIBCD031105 39946.BGIOSIBCE032638 39947.LOC_Os10g35630.1 ONIVA10G16500.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]