SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g11050.1|PACid:21948171 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g11050.1|PACid:21948171
Domain Number 1 Region: 141-488
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.76e-113
Family IF2B-like 0.0000000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g11050.1|PACid:21948171
Sequence length 508
Sequence
MNTFGRRSNTWSARTNRVLDLHRPVLYARYFARDFAGVPLPDCRTLGSTVARHCSVAPDI
LSLRTLVGGPNRITCIQRGLGEKAAKHSSDIYSSPDTQGTDKIASGGASSTRSSTPPDSP
GFLSISAEFRSAPAMGELGALQSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRD
MVVRGAPAIAIAAALALAVEVSGLEDFTGTPAEAAVFVSEKLEYLVSSRPTAVNLSDAAT
KLRSLVSRTAETEKDAKAIFQAYIDAAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDIS
VLTHCNTGSLATAGYGTALGVIRALHSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPA
TLIADSAAAALMKSGCIQAVIVGADRIAANGDTANKIGTYNLAISAKHHGVQFYVAAPIT
SIDLSLPSGEQIVIEERSPNELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEK
GVITKSDADETFNIKDFIQSAKLYSTMQ
Download sequence
Identical sequences F4MG97
39947.LOC_Os11g11050.1 LOC_Os11g11050.1|PACid:21948171 LOC_Os11g11050.1|13111.m23056|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]