SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g04410.1|PACid:21937439 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g04410.1|PACid:21937439
Domain Number 1 Region: 298-381
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 8-55,95-128,187-214
Classification Level Classification E-value
Superfamily POZ domain 7.32e-18
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g04410.1|PACid:21937439
Sequence length 494
Sequence
MSSEDSLKSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPN
HQPPPPPPPPLNWPTAGGGGGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQ
FLYSGQASVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQL
ESMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEI
RAKSPLAAAAAPRSPFLTHHYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEG
LDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLL
DHHADPNSRTLDGVTPLDVLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTR
DDGAPVTGGEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNNGR
GSPPPAMYFPNGFA
Download sequence
Identical sequences Q2QXZ2
39947.LOC_Os12g04410.1 XP_015619624.1.37577 LOC_Os12g04410.1|PACid:21937439 LOC_Os12g04410.1|13112.m00421|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]