SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g13300.1|PACid:21934232 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g13300.1|PACid:21934232
Domain Number 1 Region: 31-290
Classification Level Classification E-value
Superfamily L domain-like 9.23e-53
Family Polygalacturonase inhibiting protein PGIP 0.00026
Further Details:      
 
Domain Number 2 Region: 443-599,626-687,732-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-51
Family Protein kinases, catalytic subunit 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g13300.1|PACid:21934232
Sequence length 785
Sequence
MTTLPTAILLLLLLLALPPPSAVVALTADGLALLALKAAVTDDPLSVLSSWSESDPDPCR
WPGVTCSNVTAAGGEPRRRVVGVALAGKNLSGYIPSELGSLLFLRRLNLHDNRLAGGVPA
ALSNASSLHSLFLYGNRLTGALPAALCDIPRLQNLDVSRNALSGGLPGDLRNCRSLQRLI
LAGNSFSGEVPAGIWAEMASLQQLDISSNGFNGSIPADLGELPRLAGTLNLSHNRFSGVV
PPELGRLPATVTLDLRFNNLSGAIPQTGSLASQGPTSFLNNPGLCGFPLQVPCRAVPPPT
QSPPAPTTTTTTTTPSSASAAAAAASEHHQPIRTSLIALISIADAAGVALVGVILVYVYW
KVKDRKKQGRSSTVAAGDENESRHGLCRCIWGHRGVDSDTDTDDSSASENGGGGGKYGEG
ELVAIDRGFRVELDELLRSSAYVLGKGGKGIVYKVVVGNGATPVAVRRLGGGGGGGERCK
EFAAEARAVGRARHPNVVRLRAYYWSADEKLVVTDFVGNGNLAAAMRGRPGQTPLSWSTR
LKIARGAARGLAYLHECSPRRFVHGEVKPSNILLDADFTPRVADFGLARLLAVAGCADDV
VDAPPAAPSSGGLLGGAIPYAAKPASSVAADHRGGGYRAPEARTAGARPAQKWDVFSFGV
VLMELLTGRGPGDHASPSTSASFSAPSSSSAATTDRSGSGEHGHGAGVGGAVVPEVVRWV
RRGFEEEARPVSEMVDPALLRDAPPLPKKEVVAAFHLALACTELDADLRPRMKAVADTLD
KIASS
Download sequence
Identical sequences A0A0E0RFD3 A0A0P0Y8G5
XP_015618760.1.37577 39947.LOC_Os12g13300.1 LOC_Os12g13300.1|PACid:21934232 LOC_Os12g13300.1|13112.m01411|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]