SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GS_03675 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_03675
Domain Number 1 Region: 245-342
Classification Level Classification E-value
Superfamily Colicin 0.000068
Family Colicin 0.0018
Further Details:      
 
Weak hits

Sequence:  GS_03675
Domain Number - Region: 53-115
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0366
Family HBL-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_03675
Sequence length 354
Comment GS_03675 GS_03675
Sequence
MEQQKAVADSLAVARETLRGYRDISDGVAKQVRDEVRNEVQNLDVAGLIGERISQDFQRL
EESVANMKANADALNRDIATIHSNIVQEYNTLKGYSWKWLGGVSVAFLVMFCVLGWGMKT
MLDRNYNATAAVYQKVVILEDKLAEKPVTGLGHNGGKPSGNVNGSSGHGGPSSGGGYHYN
PGKGPASTVGPDGEVHINITGGREKDPPGKHHGNGGSGNGHGAGNHNSNSGGNGKTTSIP
GWSPDSGKPGRYLPTNKDKLIKGLIQSIDDHSGTYTIHYTGGAVATVTVPNGDVNKMNVH
YNIGSGPSSEFKAENEANAVNDAISKVNDFYKELASKYGDKRQWKNNVYSWMEP
Download sequence
Identical sequences GS_03675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]