SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00000948001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00000948001
Domain Number 1 Region: 117-190
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-21
Family ZZ domain 0.0057
Further Details:      
 
Domain Number 2 Region: 41-135
Classification Level Classification E-value
Superfamily EF-hand 4.42e-20
Family EF-hand modules in multidomain proteins 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00000948001
Sequence length 192
Comment pep supercontig:AMS_PRJEB1171_v1:HG380760:505833:506742:-1 gene:GSADVG00000948001 transcript:GSADVT00000948001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEIVETLLKFLCDILHIEENQDFDHNSFKIILFALSNAKLPEKYRCFFRQITSPNVIAT
QGKLTELFEILLKVPNHFDNVDSFHPDNIPGCVQSCLDHTHDGLIREDIFVNWMSREPQT
LVWLPTLHRLIATETVRHEARCNTCKAYPVIGMRYRCLRCFNYDLCQTCFFTGDHAKKHD
GSHPIEEYCKQV
Download sequence
Identical sequences GSADVT00000948001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]