SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00001115001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00001115001
Domain Number 1 Region: 5-191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-56
Family G proteins 0.000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00001115001
Sequence length 206
Comment pep supercontig:AMS_PRJEB1171_v1:HG380760:931333:932245:1 gene:GSADVG00001115001 transcript:GSADVT00001115001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRKKVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKELQIDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVMDVTSPTSFKSLESWKDEFLIQAGPRDPENFPF
VVIGNKIDLENRMIQARKAQAWCQEKNNIPYFETSAKEGVNVEKAFETVARNALAREKEI
DQQTDFPMPIRIPQQEEQAKKEGCSC
Download sequence
Identical sequences GSADVT00001115001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]