SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00003925001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00003925001
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.00000000241
Family DmpA-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00003925001
Sequence length 70
Comment pep supercontig:AMS_PRJEB1171_v1:HG380769:126589:126801:1 gene:GSADVG00003925001 transcript:GSADVT00003925001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHDRYARAINPIHTMFDGDTIFTLATGASTVSTINLIGLLATEVIEQAIIRAVEQASSL
PNLLNLHELH
Download sequence
Identical sequences GSADVT00003925001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]