SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00005442001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00005442001
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000123
Family Calbindin D9K 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00005442001
Sequence length 69
Comment pep supercontig:AMS_PRJEB1171_v1:HG380774:246226:246541:-1 gene:GSADVG00005442001 transcript:GSADVT00005442001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDKTTDLRSEFDRLDCDKDGYITLKEFRAYHEQNNKDGTSIEKAFAAIDADNDGMVTF
EEFQRAYKG
Download sequence
Identical sequences GSADVT00000958001 GSADVT00005442001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]