SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00009587001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00009587001
Domain Number 1 Region: 257-501
Classification Level Classification E-value
Superfamily SPOC domain-like 5.1e-53
Family Ku80 subunit middle domain 0.0000456
Further Details:      
 
Domain Number 2 Region: 5-198
Classification Level Classification E-value
Superfamily vWA-like 2.3e-32
Family Ku80 subunit N-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00009587001
Sequence length 502
Comment pep supercontig:AMS_PRJEB1171_v1:HG380791:333290:335784:-1 gene:GSADVG00009587001 transcript:GSADVT00009587001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHSKEALALVVDIGAGMCDAIPGYDSPLQMASDILQMIVQRKMFQESKDELALILYGAD
ESNNDLADEDNYRNINVVFPLSPANWHLFEEIQKIKPGNNPADLVDAVVVAADHLRRETE
GKHGFAAKRVMLFTNAATTFSDHSLKTILDSLRRQDIIVDAIGPTWGQADEDDNQENNYS
DSPIELNGNDNDEEQSDAARSTTNGHQNHQTQKKPLTQQQQTGIRVIGEIVNNTEGTLFT
FREALTILSVHQSKIVKPTATKYIMQLADLKLHICTYIQVKDNKPGIFRFKKVYARDPTT
EIKVDRGRYTKDEQDQEIEKEELTDGFRYGTTFVPINKETLDEMKYQSEKCFSIIAFSDA
NMMKRSLYLGDTVYEVIAEASFEVSQAFAGLVQAMYDTNTVAIVRKCFSERSAPELGYLR
PHIAHDHICMYYIKLPFAEDLREFEFDNLDAIKKNHPSDEQLKCIDNLITAMDLTHADRG
GEEALRPEYVFNPYIQRMFQVC
Download sequence
Identical sequences GSADVT00009587001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]