SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00013952001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00013952001
Domain Number 1 Region: 273-559
Classification Level Classification E-value
Superfamily SPOC domain-like 9.81e-69
Family Ku70 subunit middle domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 32-254
Classification Level Classification E-value
Superfamily vWA-like 5.08e-40
Family Ku70 subunit N-terminal domain 0.000032
Further Details:      
 
Domain Number 3 Region: 594-638
Classification Level Classification E-value
Superfamily SAP domain 0.0000000336
Family SAP domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00013952001
Sequence length 642
Comment pep supercontig:AMS_PRJEB1171_v1:HG380813:84777:87228:-1 gene:GSADVG00013952001 transcript:GSADVT00013952001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLDQNWGGTGGGGDDDALDDNQQGKQILTSRDGTLMLIECAPEMFESLSNTMKTDSST
NDDNDDEDLTTGFQLIMRACQRFYQSKIISNDKDLSGIILYGTEKNKNTFDFNHIYILHE
LAQPSAERIIQLENLSKQDTFKKTYKDLFGSTQSKGYSLNEALWTCSNLFSNSPQRLTIK
RVFIFTCNDQPHASNLTLERQAKQRAKDLNDVGIQVEVFPILTETRTTFDYKKFFQDVLM
LSDDELELRNNQAPTGRLNELLKLVYSKEHKKRAYCTVPFSLGTASDGTPLQLSVSIFNM
VRPCTKPSKIKLDMKTNMETKTVTKHYLPETAEILMPSDIQYGIDVSNRRVLFDADEIKA
IKKFADPGLEILGFKSLSCLLPHHYVKPGHFIYPDEKYIEGSTCLFNALLKKCLEKQMFI
LCQFTARRNTSPRLVALIPQAEEINKKDPTDRLASNGFHVHYLPYADDIRTLPKNDVARL
SDDQVDVFKNVIRGLKFKYRPEKLENPALQTLWRNIEATALNKDKPEEFIDLTVPNEENQ
NKKVGQYVTEIKQMFFPPDYVMGVTKRTAVKRKAETTAISSSVKRSKSDENIDVEAAARN
NLLNKLTVPILKDYCKEKNLRANGTKKQDLIDAIEKHLTITT
Download sequence
Identical sequences GSADVT00013952001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]