SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00015759001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00015759001
Domain Number 1 Region: 81-158
Classification Level Classification E-value
Superfamily EF-hand 0.00000566
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00015759001
Sequence length 171
Comment pep supercontig:AMS_PRJEB1171_v1:HG380822:263835:264642:1 gene:GSADVG00015759001 transcript:GSADVT00015759001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNKNIHLSTDEFNLSIFIYYRSRVDVNAIDYKKFCEEIESIFTTDFLEKNPLVDSEQYV
PIKDAANIRMDPDKEDRIKVLMEKMAKRVHARRFQLFPLFEDFDRVRNGHVTQSQFLRVL
NDLGLLTLLSGFEKDNLLEKFRVRIGGRDDMDYLTFCHELNTLAGFEAGIP
Download sequence
Identical sequences GSADVT00015759001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]