SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00015998001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00015998001
Domain Number 1 Region: 220-506
Classification Level Classification E-value
Superfamily SPOC domain-like 1.33e-68
Family Ku70 subunit middle domain 0.00000135
Further Details:      
 
Domain Number 2 Region: 14-201
Classification Level Classification E-value
Superfamily vWA-like 3.81e-36
Family Ku70 subunit N-terminal domain 0.0000417
Further Details:      
 
Domain Number 3 Region: 541-585
Classification Level Classification E-value
Superfamily SAP domain 0.0000000305
Family SAP domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00015998001
Sequence length 589
Comment pep supercontig:AMS_PRJEB1171_v1:HG380823:351571:353805:1 gene:GSADVG00015998001 transcript:GSADVT00015998001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTDSSTNDDNDDEDLTTGFQLIMRACQRFYQSKIISNDKDLSGIILYGTEKNKNTFDFN
HIYILHELAQPSAERIIQLENLSKQDTFKKTYKDLFGSTQSKGYSLNEALWTCSNLFSNS
PQRLTIKRVFIFTCNDQPHASNLTLERQAKQRAKDLNDVGIQVEVFPILTETRTTFDYKK
FFQDVLMLSDDELELRNNQAPTGRLNELLKLVYSKEHKKRAYCTVPFSLGTASDGTPLQL
SVSIFNMVRPCTKPSKIKLDMKTNMETKTVTKHYLPETAEILMPSDIQYGIDVSNRRVLF
DADEIKAIKKFADPGLEILGFKSLSCLLPHHYVKPGHFIYPDEKYIEGSTCLFNALLKKC
LEKQMFILCQFTARRNTSPRLVALIPQAEEINKKDPTDRLASNGFHVHYLPYADDIRTLP
KNDVARLSDDQVDVFKNVIRGLKFKYRPEKLENPALQTLWRNIEATALNKDKPEEFIDLT
VPNEENQNKKVGQYATEIKQMFFPPDYVMGVTKRTAAKRKAETTAISSSAKRSKSDENID
VEAAARNNLLNKLTVPILKDYCKEKNLRANGTKKQDLIDAIEKHLTITT
Download sequence
Identical sequences GSADVT00015998001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]