SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00016486001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00016486001
Domain Number 1 Region: 280-342
Classification Level Classification E-value
Superfamily R3H domain 0.00000000804
Family R3H domain 0.0064
Further Details:      
 
Domain Number 2 Region: 109-175
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000513
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00016486001
Sequence length 403
Comment pep supercontig:AMS_PRJEB1171_v1:HG380826:278835:280110:-1 gene:GSADVG00016486001 transcript:GSADVT00016486001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRGEERPSRWGPPTNLSAVTPSSTSAVRHFHERRVEEGSQREREYHTTNGICIPPPAL
IEPPLTRVDLGKDLSKCTSSTDEAIANNIRRLIPNTFVVFELLDFDENIPGHYVSMLFTS
LSKNKLDLKYEFIHVPNGFMITYSINNRFFMSWIAPTKVAAKQMGAKKAIEMLKTLYPSI
KTKHVVTDMSMNENEIQGIKCRLIRRAQLYEQSSLATSMTTTNNTAPPKEDMGSKLLKKM
GWIGGGIGKDLQGIAEPIQIEDLQGRKGLGSSSLFPNQMFIKNLRQLLEDFITNNDNDDE
LQFANEFNSEERKTIHKEAMKLHLTSNSYGRDGERRIRITQKRNVDQLVDHLLTHGGETA
RYELKAQTQPRSITQTLSQRKYGQIAPPSSQWTAPDACDDENL
Download sequence
Identical sequences GSADVT00016486001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]