SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00016947001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00016947001
Domain Number 1 Region: 13-123
Classification Level Classification E-value
Superfamily EF-hand 2.45e-28
Family Calmodulin-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00016947001
Sequence length 124
Comment pep supercontig:AMS_PRJEB1171_v1:HG380829:231839:232460:1 gene:GSADVG00016947001 transcript:GSADVT00016947001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKTSKHKKDLTHLSDEEIERLTKNTTYSRQQINDWHQGFLRDCPSGKLDKKKFLEVYK
KFYPEGKAEKFCSQVFKTFDSDDNGYIDFVEFLIAVNITSHGDIREKLRLAFDMYDMNKN
GKVI
Download sequence
Identical sequences GSADVT00016947001 GSADVT00034304001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]