SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00019692001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00019692001
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.61e-55
Family G proteins 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00019692001
Sequence length 207
Comment pep supercontig:AMS_PRJEB1171_v1:HG380846:68967:69883:-1 gene:GSADVG00019692001 transcript:GSADVT00019692001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRSFGPGRPFKILLIGDSSVGKTSLMFRFADDKFTQTFTPTIGIDFKLKTILIRDKPI
QLQLWDTAGQERFYNIVRSYYRNADAILLVYDRTAACTFQNIVRWMKSINENAPDDVFRV
LVGNKSDLHEYLVVSNEDGRQLANQYHMNYFETSAKSDSIEKITQMFSYITETLLERRQP
VSIPPSIPINKFNESTDTIYQKLTNCC
Download sequence
Identical sequences GSADVT00019692001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]