SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00019877001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00019877001
Domain Number 1 Region: 130-234
Classification Level Classification E-value
Superfamily R3H domain 3.79e-29
Family R3H domain 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00019877001
Sequence length 890
Comment pep supercontig:AMS_PRJEB1171_v1:HG380847:127030:130151:-1 gene:GSADVG00019877001 transcript:GSADVT00019877001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEFGDSCCVPSAMVVQLTKPDKNNNTTANVDDGIILPSEQCDVIEDGTDEKSECTGDSD
ERRLSSGPDDDGVSTNNNNINTTSAIEITTIASTSSSSSSNTESEMPINNDSTTNNTNTS
TNNINTTDPYKDFSGIDTESFISTTLRNNPKDRTLLLQLETVLQQFIQNDEQTSHQFQAM
NSYERMIVHRVAAFFGLDHNVDKNGQAVVVTKTANTRIPSFSFQKCIPENESTDITSGAP
TTENSVSTINSSDIPTRRILRRHEKNPNHDHSQRNGLHDDYTNSHASSSNKTHPVTKPYL
ERVNNYAETRARIFNDSNEQSNTSITNKNLKTNQKQHSNFTRPAYRKQQHQNSSHQHRSY
SYQHSQHATNNHMQQYPTGKAMDPSSHMLNNSTSRTSSIYSTQQQSSGNLNISQPPIYAS
MIASNPNTASLRPSTGTSFYTQSQQPPVDYDYKHQTGGAHMYNYVPMIPPTASNFIQQQT
QSIHPQQPSSVGGTGGPNQVPSQHGPGIPLPILVHQQPSGQIQYIFPAHALQQQQQQQQQ
QPPTSSYPLTPDGQYVQLYRPDTLSMPSGPQTVPPPSVVDSNNSHHHQFSQNQPYHHLPH
HQISQQQQQQSQQQQQQQQQQQQQQVPLSQSNPAPQPPPFVRLYPSGQQGNVTHSFAQTA
YAPPPQTTFVPPGTIPGPSFMIPPPPPQNAGGIQTYQSFDNTISYNNYGPTTTTTGKVNT
SNNGTSVQYATNHLSALNLQGHHDDYHPRFINNQQTRFSHSNGSTVNNQQRNFMGRPLVQ
SPNGSTITPRLAVYSTSNQQYRPNRPYNNSTTDKQLTSIENDPKALISTQQQQQTNSDNI
SLAGPAQGKIDNFHYFSSKYWKYFFSSFQSDPTTAPPSMHIYTHTYTHEI
Download sequence
Identical sequences GSADVT00019877001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]