SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00020387001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00020387001
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily EF-hand 2.98e-24
Family Calmodulin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00020387001
Sequence length 181
Comment pep supercontig:AMS_PRJEB1171_v1:HG380850:143477:144022:1 gene:GSADVG00020387001 transcript:GSADVT00020387001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRQPVAAWNTWDINAYSQLTGLSPAQIQQLYVAFNQQAASTGGRMTINEFKNIYASIV
GISWTFNSDAERVFLMFDTDGNGVLSFEEFLMAYLMLQRGVTPVQRWSYAVNYYPLTQPG
YLSAQEAQLLFNNMQQFYNIPVQNTYFTQAWSQLGGGVNGYVPASSFIQAVVPLIPQTYI
W
Download sequence
Identical sequences GSADVT00020387001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]