SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00021445001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00021445001
Domain Number 1 Region: 1382-1556
Classification Level Classification E-value
Superfamily SPOC domain-like 6.28e-41
Family SPOC domain 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00021445001
Sequence length 1562
Comment pep supercontig:AMS_PRJEB1171_v1:HG380857:210089:215087:-1 gene:GSADVG00021445001 transcript:GSADVT00021445001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLGTKVPQLTLERIDPKSIKTSSESSNKSSSTTTTTKAIKLKRANVIQSDSDSEKKTS
STTTTSTDVQKTKKSLLNNEITKRKQQHQQKPTLMTKKGQVVKTKPKTSTTNAIRKPSVT
DTHSSDESDNDEKKTEQTTTTTTSDHDQASSDSDGKTKKEPIKKRTKTMNKNKIKSTQNS
NSWRELRQDTSMYDRIKKRARNEQTRNSSLSTSEDHLSDENSDEDDDDNNEDDDEEDNHK
SNRSNNITSRRPNVMSDSSDSEIEIRSKTKTKKPTVFDNNIFDAEESDDNSKSNNRKNKI
PQTQTQPQPQPQTKKPILKTNNEQTKKEKTSKIVEEQSATKKKITILKPPEKKKSTVNTT
KPLTKTTKTTTSAQKRPSTDESNESTKKIKLDEEKSKTITTSTTTIEEQNPPTPPPPVQI
ESTISTSDKPSIVITSPPNEPVSVETNPPVTPTKFGIVFTSHHRHSTTTPIASIRKQSTE
TSTSHETSKNDDEEMDDDHRSVSIPNDKTTNKDEQTPSNANTLKPPTATAQSALSDDETL
NPETMQLSDLIGGSRREEPTKKSAPSRSTVKTTGKGKRTSKHETLANKRQQTKTNAKGVQ
PTVSTEKQPVPPVKPTESTVVVPVEQPSTISTTAKRLSTAESSTTASSINEKEAKRLRKS
TDNLPVQTQVKLEPIENISQWSTNTKIKEECMEPILSTEIHKHEISLPLPSTPVPDQSQI
TSMETEQIPPSSSIINSTHSPSTTSTETDNAIKALCPSIQIPQQTISKSSNQEKSSPIIA
PISKETLPIVEHQPTAISTTSILPPHVSIKSSLTSATFNENVEETLSAVNSLLMLNNNPP
NLAGDHPVMKGTARIAPTISKPVYSFVASLPSPTDQQTRQPPITTPTTTATVTTPSTQQN
DLITMVSNIVSSNNLNTDKPSVTTTATTTTTSATGTASTRSHIEEVIDDVAKGISTTATT
AIVTESTTSMVDTNSLISSSVGVTSTTTSAPSKTTPIPNILRDVMKTPCLTSSTTVTTST
TTTSVAATTASETLNLFDSHCRSTSPLKTIISTSTATSTTAPTSVTSVAPVIVRPTVSKS
SSSSSHKHSSTSKTDTPPPSRSPIPHPFPHMLTSDGNLFAAAAHHSNFPFALFAQLPSNA
SNSAGTPPSNLLASSLVSNSPPLATRISSGNNSSSSTSSHMINSAFLNTIMTGQQNPSLP
SNTSQHTHEKASRRDSVTKVPGTSSSSLSNRSTSIQQTVPVPIALTIPSSSSSSSSSSSI
SNATNNNLINQQQSSPLLSSLDAATAAAVAMRQQASPLQQYLGADPVAPYRNVFADAAEL
YGTPPGLYPPQNIAYAAAAQQMLNVMSITGNHHPSAAAFADLYSNSDSYFRLNPPTNELS
RDPYNVQWQGNLILKSDQAYVKTQLVAGSPQIARASMNYWNSDSSSSTSSNLQTPSTHNL
RISQRMRLEQAQLEGVQKRMQMDNDHCILIAEPYGSTPDEIRLQQNNLKNGVIRYFDEKK
AAGIVNVLLPGASQPAYVVHIFPPCQFASEILQKRAPDTYRCVVQNKIEQIYLLIVITST
VQ
Download sequence
Identical sequences GSADVT00021445001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]