SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00024197001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00024197001
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.00000000000000377
Family Decarboxylase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00024197001
Sequence length 111
Comment pep supercontig:AMS_PRJEB1171_v1:HG393871:107:548:1 gene:GSADVG00024197001 transcript:GSADVT00024197001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKGALTNNEDYVKGAVQCAKKYSDFVIGFISQSRLTTDNQYFHCTPGVHLSNTGDQLG
QQYVTPRQAIDGRGADILIVGRAILDSINRVKTAQEYQEEGYQAYEQLRHV
Download sequence
Identical sequences GSADVT00024197001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]