SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00025437001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00025437001
Domain Number 1 Region: 48-106
Classification Level Classification E-value
Superfamily EF-hand 0.00000115
Family Parvalbumin 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00025437001
Sequence length 111
Comment pep supercontig:AMS_PRJEB1171_v1:HG398196:1:459:1 gene:GSADVG00025437001 transcript:GSADVT00025437001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INIMLFTRNTTSRISWIIFTVIAIQIAQTLSAYTDVPPPPTRPERFHSREELKRYLQLVH
EYYAIIGRPRFGRSQTEKISEPNDRQLFDFFDVNGDKSIGFDEFYQRLENK
Download sequence
Identical sequences GSADVT00025437001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]