SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00025640001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00025640001
Domain Number 1 Region: 8-63
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000328
Family Calmodulin-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00025640001
Sequence length 63
Comment pep supercontig:AMS_PRJEB1171_v1:HG399187:136:380:-1 gene:GSADVG00025640001 transcript:GSADVT00025640001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKKFKHGIQVFLKDCPSGKLDKKQFLNVYKKFYPEGKADKYCNFVFKAFDVDNNNWIDFT
EFL
Download sequence
Identical sequences GSADVT00025640001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]