SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00027049001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00027049001
Domain Number 1 Region: 191-311
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000167
Family Barwin 0.017
Further Details:      
 
Domain Number 2 Region: 65-94
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.000000943
Family Hevein-like agglutinin (lectin) domain 0.051
Further Details:      
 
Domain Number 3 Region: 112-140
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0000034
Family Hevein-like agglutinin (lectin) domain 0.071
Further Details:      
 
Domain Number 4 Region: 154-181
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.00000457
Family Hevein-like agglutinin (lectin) domain 0.039
Further Details:      
 
Domain Number 5 Region: 23-47
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0000327
Family Hevein-like agglutinin (lectin) domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00027049001
Sequence length 311
Comment pep supercontig:AMS_PRJEB1171_v1:HG380866:159358:160591:1 gene:GSADVG00027049001 transcript:GSADVT00027049001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLITSVGLLLLSMVYGAAGNCLVSGCAGGMCCSAYGYCGSGVTYCGAAGAGAGAGAGAGA
GAGAGGNCRTVGCAAGQCCSQYGYCGTTAEHCGGAGAGAGGGYVVVNPGSGSCGGAGCPA
GSCCSTYGFCGNTAAHCGGAVAGAGAGAGASYGNCGASGCGAGLCCSKHGYCGSTAAHCT
WSRLMPRKQPASLEGEFRSQARYYNETKASYEYSTCGLSRALSLDEDDQKIYTAALNEAQ
FDPYTKDGIPSTNPICEKKAIAKGANGEIIVRFVDRCLGCKEGEIALTYDGFLAVAGELG
DGHADIVWHFI
Download sequence
Identical sequences GSADVT00027049001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]