SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00027491001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00027491001
Domain Number 1 Region: 84-235
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.83e-61
Family Mammalian PLC 0.0000262
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily EF-hand 0.00000304
Family EF-hand modules in multidomain proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00027491001
Sequence length 252
Comment pep supercontig:AMS_PRJEB1171_v1:HG380869:126114:127200:1 gene:GSADVG00027491001 transcript:GSADVT00027491001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVDELLYFLQIIQKQKILIYSSKDKFTVESVTTREQVEDLIDEYETDIDLKEQKLLSLD
GFRNLLLSDEFSIMKPWCSRRVYQDMTRPLSDYYINASHNTYLFDNQIYGDSNPEAYNRA
LRAGCRVLEIDCYDGDDGQPIVTHGYTFVRSCSFESIIRLIEPNLFKTSPYPVILSIENH
CSIQQEKEIARILREILGNRLLTQPPFSRNSWLLPSPEDLKYKVLIRVSHFLELRRPKKL
FCHLYSSVVLEC
Download sequence
Identical sequences GSADVT00027491001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]