SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00030102001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00030102001
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000000569
Family R3H domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00030102001
Sequence length 97
Comment pep supercontig:AMS_PRJEB1171_v1:HG380889:55341:55744:-1 gene:GSADVG00030102001 transcript:GSADVT00030102001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRHHLPFERISWFEDDVIPFFKENPDSVYLRDLNNGFDRMLLHAVCQYLNLISKSFTR
DGERYTQVENRRMEFIPPIILLSEYMKTMDGTMKKDL
Download sequence
Identical sequences GSADVT00030102001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]