SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00030273001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00030273001
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily EF-hand 3.11e-43
Family Calmodulin-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00030273001
Sequence length 140
Comment pep supercontig:AMS_PRJEB1171_v1:HG380890:206882:207465:1 gene:GSADVG00030273001 transcript:GSADVT00030273001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELRNTFDLFDRDKSGAISSSELKQVLIALNFDPTERLLRKIMKEMDIDRNGLVEFDEF
VKVMRNVYERKFTDNEMRKAFQCFDADSSGYITINELREVLSRLNYNVSEHRLSEVLGEI
DTDNDGKISYDEFVQMLQSI
Download sequence
Identical sequences GSADVT00030273001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]