SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00031510001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00031510001
Domain Number 1 Region: 41-124
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000745
Family EF-hand modules in multidomain proteins 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00031510001
Sequence length 133
Comment pep supercontig:AMS_PRJEB1171_v1:HG380901:10519:10967:-1 gene:GSADVG00031510001 transcript:GSADVT00031510001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGGQPHISRKMEDHVHDLNHMKHDLEQQINKPVEQMTLEEQNFYYFKLHDTNNDNRLD
GLEVIAAFDHTHDELQSNTTTNANNDTHEPRIADEELTSLVDDILKDEDLNRDGFITYEE
FKHSLDRTAATQS
Download sequence
Identical sequences GSADVT00031510001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]